Stationary phase is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Updated 2025-07-10. Numbers and descriptions here follow the published literature rather than marketing material.
System suitability testing is performed before and during analytical runs to confirm that the instrument and method are working as expected. Typical checks include retention time, peak area precision, resolution between critical pairs, tailing factor, and theoretical plate count. Acceptance criteria are set in the method or pharmacopeial monograph. If a suitability check fails, the run may be rejected and the instrument or sample preparation may need investigation. This practice helps prevent release of data from a system that has drifted out of control.
Quality control samples are inserted at intervals to monitor accuracy and precision throughout a batch. Blank samples detect contamination, while spiked samples assess recovery from the sample matrix. Calibration standards establish the relationship between detector response and concentration, and control samples are prepared independently from them whenever possible. Laboratories also participate in proficiency testing and maintain audit trails, instrument logs, and reagent records. Ongoing review of control charts can reveal trends before they cause out-of-specification results.
Method validation demonstrates that an HPLC procedure is suitable for its intended purpose. Common validation parameters include accuracy, precision, specificity, linearity, range, limit of detection, limit of quantification, and robustness. Accuracy reflects agreement with a reference value, while precision describes repeatability under defined conditions. Specificity shows whether the method can measure the analyte in the presence of impurities or matrix components. Validation documents are reviewed before a method is used for routine testing or regulatory submissions.
Routine HPLC testing depends on controlled reagents, calibrated instruments, and documented procedures. Columns degrade over time, so retention times and peak shapes are monitored for drift. Mobile phases are filtered and degassed to prevent pump damage and detector noise. Reference standards must be traceable and stored under suitable conditions. Data handling systems record injections, calculations, and audit trails. Quality control samples interspersed with unknowns help detect errors during a run.
Developing an HPLC method begins with defining the purpose, such as quantifying a main component, measuring impurities, or confirming identity. Analysts select separation mode, column, mobile phase, detection, and sample preparation based on analyte properties and matrix. Experiments vary solvent strength, pH, buffer type, and temperature to achieve resolution between critical peaks. The goal is a robust method that produces reliable results across instruments and operators. Method development often involves trial runs and statistical optimization.
| Property | Value | Notes |
|---|---|---|
| Validation parameter | Accuracy | Closeness to a reference value. |
| Validation parameter | Precision | Repeatability or intermediate precision. |
| Validation parameter | Linearity | Proportional response across a range. |
| System suitability check | Resolution | Separation between adjacent peaks. |
| Quality control tool | Control chart | Tracks results over time for trends. |
System suitability testing is performed before and during analytical runs to confirm that the instrument and method are working as expected. Common checks include retention time, peak area, resolution between critical pairs, tailing factor, and theoretical plate count. Results are compared with predefined limits, and a failed check requires investigation before sample results are reported. Quality control samples at low, middle, and high concentrations are injected at intervals to monitor accuracy and precision. Blank injections detect carryover and contamination, while control charts track performance over time.
Data handling and documentation are central to HPLC quality control. Electronic systems should have audit trails that record changes to methods, sequences, and results. Integration parameters, such as peak baseline and threshold, can affect reported areas and must be defined in advance. Out-of-specification results trigger a structured investigation that may include reanalysis, instrument checks, and review of sample preparation. Regulatory inspections often examine raw data, audit trails, and training records to verify that reported results are traceable and reliable.
Key performance measures include retention time, peak area, peak height, resolution, tailing factor, and plate count. Retention time helps identify a peak under fixed conditions, but confirmation often requires a second method or detector. Peak area and height relate to concentration through calibration curves, which may be linear or nonlinear depending on the detector response. Resolution describes separation between adjacent peaks, while tailing factor and plate count describe peak shape and column efficiency. Performance checks verify these values before and during a run to confirm that the instrument is performing within limits.
High-performance liquid chromatography testing separates components of a liquid sample by forcing a mobile phase through a packed column. The stationary phase inside the column interacts with analytes to different degrees, so each compound exits at a characteristic retention time. A pump delivers solvent at controlled flow and pressure, while an injector introduces a precise sample volume. Detectors such as ultraviolet-visible, fluorescence, refractive index, or mass spectrometric instruments record the separated bands. The resulting chromatogram provides qualitative and quantitative information about the mixture.
Instrumentation includes a solvent delivery system, an autosampler, a column oven, and one or more detectors. Reversed-phase columns with chemically modified silica are widely used, but normal-phase, ion-exchange, size-exclusion, and affinity modes exist for specific separations. Detectors may rely on ultraviolet absorbance, fluorescence, refractive index, or mass spectrometry. Column temperature, mobile phase composition, and flow rate are adjusted to improve resolution. System pressure is monitored because rising pressure can indicate column blockage or deteriorating packing.
Separation performance depends on particle size, pore size, column length, and the chemistry of the stationary phase. Smaller particles generally improve efficiency but require higher pressure and suitable instrumentation. The mobile phase often contains buffers and organic solvents that influence retention and selectivity. Testing labs select conditions based on the analytes, sample matrix, and required sensitivity. Method development frequently involves screening several columns and solvent mixtures before a final set of conditions is chosen.
Detection in HPLC testing commonly relies on ultraviolet-visible absorbance, fluorescence, refractive index, or mass spectrometry. UV detection is widely used because many organic compounds absorb light, but it requires a chromophore. Mass spectrometry provides mass-based identification and high sensitivity for trace analytes. Each detector has trade-offs in selectivity, cost, and compatibility with mobile phases. Quantification typically uses calibration curves prepared from reference standards. Results are reported as concentration, purity, or presence above a limit.
HPLC testing separates dissolved compounds by passing a liquid sample through a column packed with stationary phase. A pump delivers mobile phase at controlled flow, and the sample components interact differently with stationary and mobile phases. Compounds that spend more time in mobile phase elute earlier; those retained by stationary phase elute later. Detectors record elution as peaks, and peak area or height relates to amount. This mechanism underpins quantitative analysis of mixtures.
The citric acid cycle is regulated mainly by the availability of key substrates, particularly the ratio of NAD+ to NADH and the concentrations of calcium, inorganic phosphate, ATP, ADP, and AMP. Citrate – the ion that gives its name to the cycle – is a feedback inhibitor of citrate synthase and also inhibits PFK, providing a direct link between the regulation of the citric acid cycle and glycolysis.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
A lot of effort has been put into controlling cell selectivity. For example, attempts have been made to modify and optimize the physicochemical parameters of the peptides to control the selectivities, including net charge, helicity, hydrophobicity per residue (H), hydrophobic moment (μ) and the angle subtended by the positively charged polar helix face (Φ). Other mechanisms like the introduction of D-amino acids and fluorinated amino acids in the hydrophobic phase are believed to break the secondary structure and thus reduce hydrophobic interaction with mammalian cells. It has also been found that Pro→Nlys substitution in Pro-containing β-turn antimicrobial peptides was a promising strategy for the design of new small bacterial cell-selective antimicrobial peptides with intracellular mechanisms of action. It has been suggested that direct attachment of magainin to the substrate surface decreased nonspecific cell binding and led to improved detection limit for bacterial cells such as Salmonella and E. coli.
Polycondensation involves the formation of polymers through condensation reactions between different species, creating condensation polymers. With automated synthesis, General electric manufactured an approach for melt-polymerizations of BPA and diphenyl carbonate (DPC), using sodium hydroxide (NaOH) as the catalyst. Once the results were analyzed, it was shown that, by using an automated method of polymerization, the effect of varying the catalyst amount became more distinct and improved the reproducibility for the reaction. Furthermore, it demonstrated an increase within the homogeneity of the polymers in the microreactors.
Freeze-drying, also known as freeze-casting or ice-templating, offers an alternative to the high temperature and high-pressure requirements of supercritical drying. Additionally, freeze-drying offers more control of the solid structure development by controlling the ice crystal growth during freezing. In this method, a colloidal dispersion of the aerogel precursors is frozen, with the liquid component freezing into different morphologies depending on a variety of factors such as the precursor concentration, type of liquid, temperature of freezing, and freezing container. As this liquid freezes, the solid precursor molecules are forced into the spaces between the growing crystals. Once completely frozen, the frozen liquid is sublimed into a gas through lyophilization, which removes much of the capillary forces, as was observed in supercritical drying. Though typically classified as a "cryogel", aerogels produced through freeze-drying often experience some shrinkage and cracking while also producing a non-homogenous aerogel framework. This often leads to freeze-drying being used for the creation of aerogel powders or as a framework for composite aerogels.
Sources: en.wikipedia.org
The DLD homodimer functions as the E3 component of the pyruvate, α-ketoglutarate, α-adipate and branched-chain amino acid-dehydrogenase complexes and the glycine cleavage system, all in the mitochondrial matrix. In these complexes, DLD converts dihydrolipoic acid and NAD+ into lipoic acid and NADH. DLD also has diaphorase activity, being able to catalyze the oxidation of NADH to NAD+ by using different electron acceptors such as O2, labile ferric iron, nitric oxide, and ubiquinone. DLD is thought to have a pro-oxidant role by reducing oxygen to a superoxide or ferric to ferrous iron, which then catalyzes production of hydroxyl radicals. Diaphorase activity of DLD may have an antioxidant role through its ability to scavenge nitric oxide and to reduce ubiquinone to ubiquinol. The dihyrolipamide dehydrogenase gene is known to have multiple splice variants.
June 29 – July 6: 2019 Men's U20 European Lacrosse Championship in Prague (debut event) England defeated Germany, 9–8, to win the inaugural Men's U20 European Lacrosse Championship title. The Czech Republic took third place. July 16 – 25: 2019 Women's European Lacrosse Championship in Netanya England defeated Israel, 10–7, to win their third consecutive and seventh overall Women's European Lacrosse Championship title. Wales took third place. August 1 – 10: 2019 FIL Women's Under-19 World Lacrosse Championships in Peterborough The United States defeated Canada, 13–3, to win their fifth Women's Under-19 World Lacrosse Championships title. Australia took third place. September 19 – 28: 2019 World Indoor Lacrosse Championship in Langley Canada defeated Haudenosaunee, 19–12, to win their fifth consecutive World Indoor Lacrosse Championship title. United States took third place.
Klibanski became chief of the Neuroendocrine Unit at Massachusetts General Hospital, studying hormones and neuroendocrinology with a focus on hypopituitarism and pituitary tumors. Her clinical research has also examined the effects of hypothalamic and pituitary disorders on body composition and bone density, including bone loss associated with anorexia nervosa and growth hormone deficiency. In 1997, Klibanski became the first woman from Mass General's Department of Medicine to become a professor of medicine at Harvard. She has authored more than 350 peer-reviewed papers and book chapters and has received the Endocrine Society Clinical Investigator Award and the Clinical Endocrinology Trust Medal from the Society for Endocrinology. Klibanski has served on the National Institute of Diabetes and Digestive and Kidney Diseases Board of Counselors and the editorial board of the Journal of Clinical Endocrinology and Metabolism, and is a past president of the Pituitary Society. She established the Center for Faculty Development at Massachusetts General Hospital and mentored more than fifty women, for which she received the Endocrine Society's Outstanding Mentor Award.
Adhesion G protein-coupled receptor G1 also known as GPR56 is a protein encoded by the ADGRG1 gene. ADGRG1 is a member of the adhesion GPCR family. Adhesion GPCRs are characterized by an extended extracellular region often possessing N-terminal protein modules that is linked to a TM7 region via a domain known as the GPCR-Autoproteolysis INducing (GAIN) domain. ADGRG1 is expressed in liver, muscle, tendon, neural, and cytotoxic lymphoid cells in human as well as in hematopoietic precursor, muscle, and developing neural cells in the mouse. ADGRG1 has been shown to have numerous role in cell guidance/adhesion as exemplified by its roles in tumour inhibition and neuron development. More recently it has been shown to be a marker for cytotoxic T cells and a subgroup of Natural killer cells. The ADGRG1 protein binds transglutaminase 2 to suppress tumor metastasis and binds collagen III to regulate cortical development and lamination.
Sources: en.wikipedia.org
Closer Roberto Osuna converted his 25th consecutive save on May 24, breaking a club record. The streak had started the previous August 18, surpassing Brad Lidge (24 consecutive from June 21–September 28, 2005). Osuna's feat remained the franchise longest until Josh Hader converted 29 consecutive from April 7 to August 29, 2024. On May 28, A. J. Hinch obtained his 500th win as manager, as the Astros toppled the Chicago Cubs, 9–6. Chicago blasted five home runs, but Houston answered with five doubles—two by Jake Marisnick (8)—and two home runs by Alex Bregman (17). Bregman collected three RBI, and Michael Brantley had two hits and two RBI as Houston scored four times in the bottom of the fourth. Josh James (2–0) picked up the victory in relief while surrendering three runs over 2+1⁄3 frames. With injuries stacking up, on May 29 shortstop Carlos Correa sustained a bruised rib during a massage session. He was forced to join fellow All-Stars Springer and Jose Altuve on the injured list (IL) and expected to miss four to six weeks.
Bont possesses no superhuman abilities, but he occasionally used Mutant Growth Hormone, a substance that temporarily enhanced his speed and strength and caused his eyes to emit a green glow. Sigourney Weaver portrays a female version of Alexander Bont, primarily known as Alexandra, in The Defenders. This version is the leader of the Hand. Alexandra is described as an "adversary" rather than a villain and was intended to be portrayed sympathically as a supporting character in Elektra Natchios' story. Alexandra is one of the five "fingers" of the Hand, who all gained immortality using the healing powers of qi. Following the death of Elektra, Alexandra resurrects her to create the ancient weapon Black Sky, which is prophesied to destroy all enemies of the Hand. Alexandra intends to use Elektra to steal the Iron Fist from Danny Rand. However, Elektra regains her memories of her previous life and kills Alexandra, claiming leadership of the Hand. http://www.marvunapp.com/Appendix4/bontalexander.htm http://www.imdb.com/title/tt1784594/
Biochemistry is the study of chemical processes within and relating to living organisms. Molecular biology is the branch of biology that seeks to understand the molecular basis of biological activity in and between cells. It is centered largely on the study of nucleic acids (such as DNA and RNA) and proteins. It examines the structure, function, and interactions of these macromolecules as they orchestrate processes such as replication, transcription, translation, protein synthesis, and complex biomolecular interactions. In 1953, the Miller–Urey experiment showed that organic compounds could be synthesized abiotically within a closed system mimicking the conditions of early Earth, thus suggesting that complex organic molecules could have arisen spontaneously in early Earth in the process of abiogenesis.
Amino acids are the building blocks of protein and together they form the protein requirements in formula needed for growth and development. The amino acids are in the simplest form, making it easy for the body to process and digest. Amino acid-based formula may be considered hypoallergenic since it does not contain peptides that may trigger an immune response. Because infants and children have different nutritional needs, amino acid-based formulas are typically formulated either for infants 0–1 years of age or for children 1–10 years of age. Amino acid-based formulas may be used for those with cow's milk or soy protein allergy. However, most infants who suffer from food allergy respond well to extensively hydrolysed formulas, and only few of those with the most severe form of the illness require the use of amino acid-based formulas. It may also be used for other medical conditions requiring an amino acid-based diet, such as short bowel syndrome, and for transition from parenteral to enteral nutrition. Milk allergy Food allergy
Alexandra C. Newton is a Canadian and American biochemist. She is a Distinguished Professor of pharmacology at the University of California, San Diego. Newton runs a multidisciplinary Protein kinase C and Cell signaling biochemistry and cell biology research group in the School of Medicine, investigating molecular mechanisms of signal transduction in the Phospholipase C (PLC) and Phosphoinositide 3-kinase (PI3 kinase, or PI3-K) signaling pathways. She has been continuously funded by the US National Institutes of Health since 1988. Newton was born in Cape Town, South Africa, and was schooled in Vancouver, Athens, and Aix-en-Provence. She graduated in 1980 from the Simon Fraser University in Canada, where she was awarded a 1st-class honours degree in biochemistry and French literature. She received her PhD in chemistry in 1986 from Stanford University, working with Wray H. Huestis on a thesis examining band 3, a red cell membrane protein.
Sources: en.wikipedia.org
Method validation is the documented process of showing that an HPLC procedure produces reliable results for a defined purpose. It examines parameters such as accuracy, precision, specificity, linearity, and robustness. Regulators and quality systems often require validation before routine use.
System suitability is a set of checks run on the chromatographic system before sample analysis. It confirms that resolution, peak shape, retention time, and response meet predefined limits. Failure can invalidate the run and trigger corrective action.
Blank injections reveal peaks or baseline disturbances that come from solvents, reagents, or the instrument rather than the sample. They help distinguish contamination from actual analyte signals. Comparing blanks with sample runs supports accurate interpretation.
It is a set of checks performed before or during an HPLC run to confirm the system works as expected. Parameters may include resolution, tailing factor, theoretical plates, and retention time precision. Failure can trigger maintenance, method adjustment, or repeat analysis.