mobile phase is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Updated 2025-08-11. Numbers and descriptions here follow the published literature rather than marketing material.
Laboratories apply HPLC testing across pharmaceutical, food, environmental, and industrial chemistry. The method can measure active ingredients, impurities, additives, preservatives, and degradation products. Sample preparation often includes dilution, filtration, and sometimes extraction or derivatization. The choice of column, mobile phase, pH, temperature, and detector depends on the analytes and matrix. Results are compared with reference standards to assign identity and concentration. Method suitability is judged by resolution, precision, and accuracy.
HPLC testing is not a single fixed procedure; it is a family of separation modes. Reversed-phase, normal-phase, ion-exchange, size-exclusion, and affinity chromatography each suit different analyte properties. Reversed-phase methods dominate because they handle many neutral and moderately polar compounds. Detection can be optical, electrochemical, or mass spectrometric, and the detector dictates what information is available. Coupling with mass spectrometry increases selectivity and enables identification when standards are unavailable. The technique cannot separate every mixture without adjustment.
Quality control samples are inserted at intervals to monitor accuracy and precision throughout a batch. Blank samples detect contamination, while spiked samples assess recovery from the sample matrix. Calibration standards establish the relationship between detector response and concentration, and control samples are prepared independently from them whenever possible. Laboratories also participate in proficiency testing and maintain audit trails, instrument logs, and reagent records. Ongoing review of control charts can reveal trends before they cause out-of-specification results.
Method validation demonstrates that an HPLC procedure is suitable for its intended purpose. Common validation parameters include accuracy, precision, specificity, linearity, range, limit of detection, limit of quantification, and robustness. Accuracy reflects agreement with a reference value, while precision describes repeatability under defined conditions. Specificity shows whether the method can measure the analyte in the presence of impurities or matrix components. Validation documents are reviewed before a method is used for routine testing or regulatory submissions.
| Property | Value | Notes |
|---|---|---|
| Abbreviation | HPLC | Also called high-performance liquid chromatography |
| Separation mechanism | Differential partitioning | Compounds distribute between mobile and stationary phases |
| Typical column chemistry | C18 (octadecylsilane) | Used in reversed-phase separations |
| Typical detector | UV-Vis or photodiode array | Mass spectrometry is common for trace and confirmatory work |
| Typical particle size | 1.8–5 µm | Smaller particles require higher pressure and can improve speed |
Key performance measures include retention time, peak area, peak height, resolution, tailing factor, and plate count. Retention time helps identify a peak under fixed conditions, but confirmation often requires a second method or detector. Peak area and height relate to concentration through calibration curves, which may be linear or nonlinear depending on the detector response. Resolution describes separation between adjacent peaks, while tailing factor and plate count describe peak shape and column efficiency. Performance checks verify these values before and during a run to confirm that the instrument is performing within limits.
High-performance liquid chromatography testing separates components of a liquid sample by forcing a mobile phase through a packed column. The stationary phase inside the column interacts with analytes to different degrees, so each compound exits at a characteristic retention time. A pump delivers solvent at controlled flow and pressure, while an injector introduces a precise sample volume. Detectors such as ultraviolet-visible, fluorescence, refractive index, or mass spectrometric instruments record the separated bands. The resulting chromatogram provides qualitative and quantitative information about the mixture.
Reversed-phase chromatography dominates modern HPLC testing, using a nonpolar stationary phase such as chemically bonded octadecyl groups and a polar mobile phase of water mixed with organic solvent. Analytes partition between the mobile and stationary phases according to hydrophobicity. Gradient elution changes the mobile phase composition over time to separate compounds with a wide range of retention. Isocratic elution keeps the composition constant and is simpler for routine assays. Column temperature, pH, and flow rate influence selectivity, peak shape, and retention time, so these parameters are controlled during a validated method.
Detection in HPLC testing commonly relies on ultraviolet-visible absorbance, fluorescence, refractive index, or mass spectrometry. A diode array detector records full spectra across a wavelength range, which helps identify co-eluting peaks. Mass spectrometry provides mass-to-charge ratios and can confirm molecular identity at low concentrations. The choice of detector depends on analyte structure, required sensitivity, and whether quantitation or identification is the goal. No single detector works for every compound, and method development often compares responses before selecting one.
High-performance liquid chromatography is an analytical technique that separates components of a liquid sample by passing it through a packed column under pressure. A pump delivers a mobile phase at a controlled flow rate, and an injector introduces the sample into the stream. Differences in interaction with the stationary phase cause analytes to migrate at different rates. Detectors record elution as peaks, and a data system converts signals into a chromatogram. The method is suited to compounds that dissolve in a liquid and are not volatile enough for gas chromatography.
In quality control laboratories, HPLC testing supports batch release, raw material checks, stability studies, and impurity profiling. A validated method defines sample preparation, instrument settings, calibration, and acceptance criteria. Analysts compare results with specifications and investigate out-of-specification outcomes before a batch is approved. Documentation includes chromatograms, integration records, audit trails, and reagent details. Because results influence product decisions, laboratories follow formal quality systems and data integrity rules. The exact tests and limits depend on the material, its intended use, and the applicable regulatory framework.
Method validation examines whether an HPLC procedure is suitable for its intended purpose. Common parameters include accuracy, precision, specificity, linearity, range, detection limit, quantification limit, and robustness. Accuracy describes closeness to a true or accepted value, while precision describes agreement among repeated measurements. Specificity shows whether the method can measure the analyte without interference from related substances. Robustness tests small deliberate changes in flow, temperature, or solvent composition. Validation is not a one-time event; methods may need partial revalidation after changes to instruments, columns, sample handling, or specification limits. Regulatory guidance provides frameworks, but some details remain method-specific.
A typical intracellular concentration of ATP is 1–10 μmol per gram of muscle tissue in a variety of eukaryotes. The dephosphorylation of ATP and rephosphorylation of ADP and AMP occur repeatedly in the course of aerobic metabolism. ATP can be produced by a number of distinct cellular processes; the three main pathways in eukaryotes are (1) glycolysis, (2) the citric acid cycle/oxidative phosphorylation, and (3) beta-oxidation. The overall process of oxidizing glucose to carbon dioxide, the combination of pathways 1 and 2, known as cellular respiration, produces about 30 equivalents of ATP from each molecule of glucose. ATP production by a non-photosynthetic aerobic eukaryote occurs mainly in the mitochondria, which comprise nearly 25% of the volume of a typical cell.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
The only drug currently approved for stroke treatment is tPA, which can cause dangerous brain bleeding. In 2005, Griffin et al proposed using Activated Protein C in conjunction with tPA to protect the brain from tPA’s harmful side-effects. APC activates protease-activated receptor 1 (PAR-1), which plays a role in the interaction of coagulation and inflammation. The 3K3A-APC was designed to have more activity at protease-activated receptor 1 (PAR-1) and less anticoagulative effect than activated protein C. The phase 2 trial, RHAPSODY, was performed in the lab of Berislav Zlokovic, the scientific founder of ZZ Biotech, to determine safety and tolerability of the drug. A phase 3 $30 million trial, RHAPSODY-2, was planned to determine safety and efficacy for treatment of ischemic stroke. However, on November 16, 2023, the National Institutes of Health (NIH) paused the start of the human trial of 3K3A-APC after an investigation by Science Magazine.
Pinhasov is a researcher at the Department of Molecular Biology and Dr. Miriam and Sheldon G. Adelson School of Medicine. His research focuses on the molecular mechanisms of mental disorders and the relationship between psychiatric deviations and stress sensitivity. His laboratory group has developed a selectively bred mouse model with strong features of dominance and submissiveness. These mice respectively exhibit manic-like and depression-like behavior with different responses to psychotropic agents and environmental stimuli, demonstrating differential sensitivity to stress. His group showed that inherited susceptibility to stress is linked to gradual development of chronic inflammation, wide-spectrum metabolic alterations, brain neurotransmission deterioration, electrical activity accompanied behavioral disturbances in emotional and cognitive domains, and reduced life expectancy. The Dominant-Submissive mouse model has been shown to be a successful and unique tool for studying the mechanisms of aging related cognitive impairments, mental disorders, and their effects on the entire organism.
In order for a protonated acid to lose a proton, the pH of the system must rise above the pKa of the acid. The decreased concentration of H+ in that basic solution shifts the equilibrium towards the conjugate base form (the deprotonated form of the acid). In lower-pH (more acidic) solutions, there is a high enough H+ concentration in the solution to cause the acid to remain in its protonated form. Solutions of weak acids and salts of their conjugate bases form buffer solutions. To determine the concentration of an acid in an aqueous solution, an acid–base titration is commonly performed. A strong base solution with a known concentration, usually NaOH or KOH, is added to neutralize the acid solution according to the color change of the indicator with the amount of base added. The titration curve of an acid titrated by a base has two axes, with the base volume on the x-axis and the solution's pH value on the y-axis. The pH of the solution always goes up as the base is added to the solution.
Sources: en.wikipedia.org
6-carboxytetrahydropterin synthase (EC 4.1.2.50, CPH4 synthase, queD (gene), ToyB, ykvK (gene)) is an enzyme with systematic name 7,8-dihydroneopterin 3'-triphosphate acetaldehyde-lyase (6-carboxy-5,6,7,8-tetrahydropterin and triphosphate-forming). This enzyme catalyses the following reversible chemical reaction. 7,8-dihydroneopterin 3′-triphosphate + H2O ⇌ 6-carboxy-5,6,7,8-tetrahydropterin + acetaldehyde + triphosphate This enzyme binds Zn2+. It is isolated from the bacteria Bacillus subtilis and Escherichia coli. The stimulation is part of the biosynthesis pathway of queuosine. The enzyme from Escherichia coli can also convert 6-pyruvoyl-5,6,7,8-tetrahydropterin and sepiapterin to 6-carboxy-5,6,7,8-tetrahydropterin. Media related to 6-carboxytetrahydropterin synthase at Wikimedia Commons 6-carboxytetrahydropterin+synthase at the U.S. National Library of Medicine Medical Subject Headings (MeSH)
Azurin is a small, periplasmic, bacterial blue copper protein found in Pseudomonas, Bordetella, or Alcaligenes bacteria. Azurin moderates single-electron transfer between enzymes associated with the cytochrome chain by undergoing oxidation-reduction between Cu(I) and Cu(II). Each monomer of an azurin tetramer has a molecular weight of approximately 14kDa, contains a single copper atom, is intensively blue, and has a fluorescence emission band centered at 308 nm. Azurins and pseudoazurins participate in the denitrification processes in bacteria., including the gram-negative bacteria Pseudomonas aeruginosa, by interacting with cytochrome c551. Azurin from P aeruginosa is a type I blue copper protein (cupredoxin), while cytochrome c551 (9 kDa) is a haem-containing cytochrome. Azurin possesses a relatively large hydrophobic patch close to the active site, and two residues in this hydrophobic patch, Met-44 and Met-64, are believed to be involved in its interaction with the redox partners cytochrome c551 and nitrite reductase. Although unrelated to its electron-transfer property, azurin has been found to have anticancer properties through its interaction with tumor-suppressor protein p53.
Aspartate transaminase, as with all transaminases, operates via dual substrate recognition; that is, it is able to recognize and selectively bind two amino acids (Asp and Glu) with different side-chains. In either case, the transaminase reaction consists of two similar half-reactions that constitute what is referred to as a ping-pong mechanism. In the first half-reaction, amino acid 1 (e.g., L-Asp) reacts with the enzyme-PLP complex to generate ketoacid 1 (oxaloacetate) and the modified enzyme-PMP. In the second half-reaction, ketoacid 2 (α-ketoglutarate) reacts with enzyme-PMP to produce amino acid 2 (L-Glu), regenerating the original enzyme-PLP in the process. Formation of a racemic product (D-Glu) is very rare. The specific steps for the half-reaction of enzyme-PLP + aspartate ⇌ {\displaystyle \rightleftharpoons } enzyme-PMP + oxaloacetate are as follows (see figure); the other half-reaction (not shown) proceeds in the reverse manner, with α-ketoglutarate as the substrate.
The binding of S-arrestin to rhodopsin is specific and involves changes that occur in rhodopsin after activation. Important serine (Ser) and threonine (Thr) residues in rhodopsin's tail, particularly Thr-340 and Ser-343, are phosphorylated by enzymes called GRKs. These phosphorylated residues strongly attract S-arrestin, helping it bind tightly and effectively shut down rhodopsin's signaling. Additionally, studies of the protein structure have shown that during activation, rhodopsin's transmembrane helix 7 (TM7) and helix 8 change shape. These changes expose a binding site that interacts with a specific part of arrestin called the "finger loop." This interaction, clearly seen in the crystal structure (PDB ID: 4ZWJ), shows how arrestin fits precisely onto activated and phosphorylated rhodopsin, efficiently stopping the visual signal. Arrestin at the U.S. National Library of Medicine Medical Subject Headings (MeSH)
ADPRase is a dimer of two identical monomers, each of which contain 209 amino acids. The two monomers are folded into two distinct structural domains and with two equivalent catalytic sites. The C-terminal domain consists of the Nudix sequence mentioned above and the N-terminal domain is primarily involved in dimer stabilization. As noted earlier, the Nudix fold is the catalytic part of the enzyme, but both domains are involved in the active site and they both help with the attachment and coordination of H2O, Mg2+, and the ADP-ribose substrate.
Sources: en.wikipedia.org
It measures the presence and amount of one or more compounds in a liquid sample. Separation occurs in a column, and detection produces a signal proportional to concentration. Identification usually requires comparison with a known reference standard under the same conditions.
In most cases the sample is consumed or altered during analysis, though some detectors are non-destructive. Fractions can be collected after separation for further study. Repeated testing therefore requires additional sample.
Run times range from under a minute for fast methods to over an hour for complex separations. Sample preparation, equilibration, and data review add time. Throughput depends on instrument configuration and method requirements.
Method validation is the documented process of showing that an HPLC procedure produces reliable results for a defined purpose. It examines parameters such as accuracy, precision, specificity, linearity, and robustness. Regulators and quality systems often require validation before routine use.